PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v0826050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 299aa    MW: 33833.2 Da    PI: 7.8779
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v0826050.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-5271311128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv +yL++k++++++ +  +i+e+d+yk++PwdLp  ++ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +
  Lj1g3v0826050.1   7 LPPGFRFHPTDEELVLHYLCRKCASQPIAV-PIIAEIDLYKYDPWDLPGLASYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGH 99 
                      79**************************99.88***************7777799*************************************99 PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + vg+kk Lvfy g+apkg kt+W+mheyrl
  Lj1g3v0826050.1 100 --PKPVGIKKALVFYAGKAPKGDKTNWIMHEYRL 131
                      ..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-624157IPR003441NAC domain
PROSITE profilePS5100560.8277157IPR003441NAC domain
PfamPF023652.3E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MASELQLPPG FRFHPTDEEL VLHYLCRKCA SQPIAVPIIA EIDLYKYDPW DLPGLASYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGHP KPVGIKKALV FYAGKAPKGD  120
KTNWIMHEYR LADVDRSIRK KNSLRLDDWV LCRIYNKKGS IERQPSGAVY SVKTESSELE  180
KRKPEILTRA AGCLPPPHPP QAPAAGVTDY MYFDASDSVP KLHTDSSCSE QVVSPEFATE  240
VQSEPKWNEW EKSLEFPYNY VDATLSNNNS NNNGFGSQFQ SGNQLSPLQD MFLYMPKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-79316311174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.63550.0cell culture| floral bud| flower| pod| protoplast| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004502479.10.0PREDICTED: NAC domain-containing protein 2
SwissprotQ390131e-149NAC2_ARATH; NAC domain-containing protein 2
TrEMBLC7AFG20.0C7AFG2_CICAR; NAC family transcription factor 5
STRINGGLYMA04G42800.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-141NAC family protein